DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG13312

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:246 Identity:56/246 - (22%)
Similarity:81/246 - (32%) Gaps:75/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 ETTTTTTTTTKPVVLTCPTISPPDTTPKPSTTTAVTKSTPKISSTE----------------QHS 506
            ||.|...|.|:...|...|     .|.:.|..|..:.....|:.|:                ..|
  Fly    99 ETQTFACTGTQSFALCLGT-----DTVQDSVGTCASGYVCNINDTQICGLPADGVMPTCSYSDDS 158

  Fly   507 TTTAKTTTTKRPTTVTEKTSSATEKPRTTVVTTTTQKRSTTTHNTSPDTKTTIRSTTLS----PK 567
            |||..::||...|.....||||:    |......:|.:....:|.....:..|..|.:.    .:
  Fly   159 TTTTVSSTTSSTTAAPPSTSSAS----TYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQ 219

  Fly   568 TTTTPS------------TTTPSTTTPSTTTPSTTTPSTTTPSTTTPST-TTTVKVSTHRPRTTS 619
            |.|.|.            :|.|||.:.:.||.|||   |..|:|:.|.. ...::.:.:.|..|.
  Fly   220 TYTCPGSMYFDSASEMCVSTMPSTCSTTATTSSTT---TAAPTTSNPEAYCQAMQSAGYYPVGTD 281

  Fly   620 QKTT----------------------------TASTTTKKTTTSPKTTKTT 642
            ..||                            :||.|.  .:|.|.|..||
  Fly   282 ASTTCHQYIDCFLNGGTWGGNMYTCPGSLYYNSASRTC--VSTLPSTCSTT 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:279884
CBM_14 221..275 CDD:279884
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.