DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG33985

DIOPT Version :10

Sequence 1:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:147 Identity:31/147 - (21%)
Similarity:50/147 - (34%) Gaps:44/147 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 PQCQKEGR---FPHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKC-------------LPG 195
            ||...:.|   .|:.:.|..||.|.:....|  .:|.....|:.:..||             .|.
  Fly   150 PQLDNQSRIALLPNQNSCSDYYICYRGVALP--MSCATSLHFNSLTGKCDHPENVRCLAMTYNPR 212

  Fly   196 DQCPSTEISDSGSYIPQNCELKFPECAEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSF 260
            :||....|.                     .:....:|..:|.||   || ||..: :||....:
  Fly   213 EQCKRHVID---------------------VYPHSDNCNYFYQCR---SG-YLMVQ-QCPFFYGW 251

  Fly   261 DLERKLCRPRSEVDCFD 277
            |.|::.|....:..|::
  Fly   252 DYEKRSCVALGQAKCYN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342 12/62 (19%)
CBM_14 221..275 CDD:426342 13/53 (25%)
CG33985NP_001034018.1 CBM_14 28..74 CDD:426342
CBM_14 160..202 CDD:426342 10/43 (23%)
ChtBD2 215..259 CDD:214696 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.