DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG13806

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:316 Identity:69/316 - (21%)
Similarity:101/316 - (31%) Gaps:92/316 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLLSVL--STATSRSV--RQLPSAYPPVLPTGYYGQPPYAYPPYGYGYQAPPPVYQP------ 63
            ||.|:::|  :|.|:|.:  |:..|.                     .|.|:|.|:.:.      
  Fly    12 LLNLVALLMGATVTTRRIQPRETNSC---------------------EGRQSPGPICESCELLAT 55

  Fly    64 ---------------------YYDNV-FGVFKSYPGGGFPVRFDYNNRCSRNYIGIKPHP-DQQQ 105
                                 ||.|. .|...:..|...|...:.|.:|:..  ||.|.| |.|:
  Fly    56 CVRHSNGWVNIPVESCDVANGYYCNARLGSCTNETGPCHPFGIEGNFQCTSQ--GIFPDPYDCQK 118

  Fly   106 Y---YYVCKPDCVIFSKCRGLESFNASSGRCVQHVPQHRPDHRPPQCQKEGRF-PHPHDCKVYYR 166
            |   |:|..........|...::|:|::|:|...:.......|...|...|.. ..|.:..::|.
  Fly   119 YHMCYFVGATLVAAAVDCGNDKAFDATTGQCTLTLTDSVCLQRQYYCPNAGHVAAWPTNPNIFYV 183

  Fly   167 CDKNRTQ---------PWLFACPAGTIFSPVERKCLPGDQC--PSTE---------ISDSGSYIP 211
            |.....|         |.|..|..|..|  |:..|..|...  |||:         ..|..|.:|
  Fly   184 CKSTVNQNLNDTIVIYPSLHRCNDGETF--VDYVCRSGSNVLPPSTDDPSVIIEDPNDDDFSVLP 246

  Fly   212 QNCELKFPECAEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLERKLC 267
            ..|:       ..|......||..||.|... :||.  ....||....:..|...|
  Fly   247 NTCQ-------HVGLMADGNDCRKYYYCSAL-NGTL--RHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 15/51 (29%)
CBM_14 150..197 CDD:279884 13/56 (23%)
CBM_14 221..275 CDD:279884 12/47 (26%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 14/54 (26%)
ChtBD2 247..293 CDD:214696 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.