DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and obst-B

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:207 Identity:53/207 - (25%)
Similarity:80/207 - (38%) Gaps:46/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 HPDQQQ--YYYVCK---------PDCVIFSKCRGLES-----FNASSGRCVQHVPQHRPD---HR 145
            :||.:|  .||.|.         .|.::|:....:|.     :|..   |::......|.   |.
  Fly    93 YPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNID---CMKRSKLQTPQPSLHC 154

  Fly   146 PPQCQKEGRFPH--PHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQ-----CPSTEI 203
            |   :|.|.|.|  |..|..:|.|...:..  :..||||.:|:|....|...||     |.|.::
  Fly   155 P---RKNGYFGHEKPGICDKFYFCVDGQFN--MITCPAGLVFNPKTGICGWPDQVGVTGCKSEDV 214

  Fly   204 SD-SGSYIPQNCELKFPECAEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLERKLC 267
            .| ....:.::..:..|..|:      |.||..:|.|   .:|. |..|..|.....||.|::.|
  Fly   215 FDFECPKVNESIAVTHPRYAD------PNDCQFFYVC---VNGD-LPRRNGCKLGQVFDEEKETC 269

  Fly   268 R-PRSEVDCFDF 278
            . .|...||.|:
  Fly   270 DWARKVPDCADW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 11/51 (22%)
CBM_14 150..197 CDD:279884 15/48 (31%)
CBM_14 221..275 CDD:279884 15/54 (28%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 10/48 (21%)
CBM_14 156..204 CDD:279884 16/49 (33%)
CBM_14 233..278 CDD:279884 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.