DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG34324

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:231 Identity:62/231 - (26%)
Similarity:76/231 - (32%) Gaps:71/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 PLRSSTETTSTQPPTTTTPQPTTTTTLTVTPKTSTTTTTTEKPITSSPKPTTTT-------QKTT 792
            |.|:.|      ||.|..|.|.||||....|..:|||....:|    |..||||       ..||
  Fly    26 PPRADT------PPCTPPPDPCTTTTCPPPPPCTTTTCPPPEP----PPCTTTTCPPPEPPPCTT 80

  Fly   793 STAPNTTKVAITTQKETTPTQSTSTTIFTRKTTTNNPEPTSTEKPITSTTPKPSTTTPKTSTVAS 857
            :|.|......|||.....|                 |.|.....|..:.||.|.|.||...|   
  Fly    81 TTCPPPPPPCITTTCPPPP-----------------PPPPPPPPPPCTRTPPPCTRTPPPCT--- 125

  Fly   858 STEKTTISSPKPTTEKSTENPTTNSVKTSALTSSTQRATSTTSEPTKTTQNITTTTPKPTTLKTS 922
                   .:|.|.|.                          |..|...|....|.||..||....
  Fly   126 -------RTPPPCTR--------------------------TPPPCTRTPPPCTRTPPCTTTPPC 157

  Fly   923 TQEATTSTQKVSTVTITTKKATESSPLTTLSTEEPN 958
            |...|| |:..:|...||.|:..:.|:...:.|:|:
  Fly   158 TPPCTT-TKPCTTTVCTTPKSDNAGPIVDGNEEQPD 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:279884
CBM_14 221..275 CDD:279884
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.