DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and R02F2.4

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:258 Identity:44/258 - (17%)
Similarity:78/258 - (30%) Gaps:100/258 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASSGRC-----VQHVPQHRPDHRPPQC 149
            ||.:||             :|......|..|.....::.::.:|     :....|...::    |
 Worm   132 CSSSYI-------------ICNSGSPRFLSCSTPLIYDPTNKKCSWKGMIDECSQVSGEY----C 179

  Fly   150 QKEGRFPHPHDCKVYYRCDK---NRTQPWLFACPAGTIFSPVERKC-LPGDQCPSTEISDSGSYI 210
            :.:|.........|::.|.:   :|..     |||..:|:|....| .|.:....:|.|:.    
 Worm   180 ESDGNISKSECSNVFFSCSEGIAHRRN-----CPANLVFNPAISSCDWPKNVMDCSEKSEK---- 235

  Fly   211 PQNC-----ELKFPECAEEGTFRSPT-----------------------------DCALYYT--- 238
            ||||     ...|..|:  .:|.:.|                             :|.|..:   
 Worm   236 PQNCGEVDGYFSFGRCS--SSFSACTNGIPIVMFCPDGLMFSEKNQMCDYEWNVDECDLESSGFM 298

  Fly   239 -----------CRLQESGTYL--------------QTRFKCPGSNSFDLERKLC-RPRSEVDC 275
                       |...::|.|.              :..|:||.|..|:....:| .|.:.:.|
 Worm   299 ENYKASEALTPCTNMDNGLYALDCTPRVLSCQNGRENIFECPPSLVFNENSLICDYPETSLKC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 8/50 (16%)
CBM_14 150..197 CDD:279884 11/50 (22%)
CBM_14 221..275 CDD:279884 15/111 (14%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 8/45 (18%)
CBM_14 185..229 CDD:279884 10/48 (21%)
ChtBD2 240..283 CDD:214696 4/44 (9%)
CBM_14 310..361 CDD:279884 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.