DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and LOC1277042

DIOPT Version :10

Sequence 1:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:XP_316470.4 Gene:LOC1277042 / 1277042 VectorBaseID:AGAMI1_001650 Length:577 Species:Anopheles gambiae


Alignment Length:78 Identity:19/78 - (24%)
Similarity:35/78 - (44%) Gaps:16/78 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VSSITST------LWLSQTSLLIILVPSTTLFVKFNLPTSI---SETTLKVQNQ---LLKSLVFQ 244
            :.|:|.|      |...:|::|....|..|   ::.||.:.   :..|..:.:|   .:|:.||:
Mosquito    35 LKSVTPTCGAPFDLEQGRTAMLKASSPVGT---EYYLPLAFKKGNRVTRNISDQEMAAIKTGVFE 96

  Fly   245 TI-IHAIMLGIPN 256
            .| .|..:|.:.|
Mosquito    97 GIDYHHDILNVIN 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342 1/4 (25%)
CBM_14 221..275 CDD:426342 11/43 (26%)
LOC1277042XP_316470.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.