DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and LOC1270272

DIOPT Version :10

Sequence 1:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:XP_308954.4 Gene:LOC1270272 / 1270272 VectorBaseID:AGAMI1_013065 Length:208 Species:Anopheles gambiae


Alignment Length:148 Identity:37/148 - (25%)
Similarity:56/148 - (37%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLP---GDQCPSTE-ISDSGSYIPQNCEL 216
            ||..||..|..|  :.|:.....||.|:.:...|..|||   ..:|...: ::.....|...|..
Mosquito    31 PHATDCTRYLVC--SGTKAIELRCPPGSEWDADETTCLPFTSESKCAVLQSLALDAPPIVNKCPP 93

  Fly   217 KFPEC------AEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLERKLC--RPRSEV 273
            :...|      |:|..|...:||..:|.|     .:.:.....||....::.|...|  ...:..
Mosquito    94 QLSRCPVYANPAKEVIFMPHSDCKKFYAC-----VSAVPVELSCPTRLYWNHESCQCDYAHSAGT 153

  Fly   274 DCFDFVPGP---VQVPYA 288
            ||| |..||   |:..|:
Mosquito   154 DCF-FAGGPPPTVRAAYS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342 14/43 (33%)
CBM_14 221..275 CDD:426342 12/61 (20%)
LOC1270272XP_308954.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.