DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and KCTD17

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_011528676.1 Gene:KCTD17 / 79734 HGNCID:25705 Length:370 Species:Homo sapiens


Alignment Length:172 Identity:108/172 - (62%)
Similarity:134/172 - (77%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNY 83
            |..:||:||||||.||||:.||.|:..||||||.|.: :|.|||||||||||||||.||.|:||:
Human    28 GWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGE-ELQSDRDETGAYLIDRDPTYFGPILNF 91

  Fly    84 LRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQR-PQTDKKRVYRVLQCREQELTQ 146
            ||||||||| .::||||||||||||:..||.::|:.:..:|.. .|...|.|||||||:|:||||
Human    92 LRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQ 156

  Fly   147 MISTLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKECGTT 187
            |:||:|||||||||:::..: |||..:..|||||||||..:|
Human   157 MVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHST 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 67/99 (68%)
BTB_2 24..112 CDD:280393 63/88 (72%)
KCTD17XP_011528676.1 BTB 32..131 CDD:197585 67/99 (68%)
BTB_2 33..121 CDD:280393 63/88 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145622
Domainoid 1 1.000 137 1.000 Domainoid score I4894
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3380
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm40345
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.