DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and kctd2

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001038899.1 Gene:kctd2 / 751724 ZFINID:ZDB-GENE-060825-85 Length:267 Species:Danio rerio


Alignment Length:204 Identity:125/204 - (61%)
Similarity:159/204 - (77%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPNVLKKQGTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPK 75
            ||...:|.|: :||:||||||||:|||.||.|||.|||.||.|||.||.||:||||||||||||.
Zfish    67 SPEATEKPGS-RWVRLNVGGTYFVTTKQTLCRDPKSFLYRLCQEDPDLDSDKDETGAYLIDRDPT 130

  Fly    76 YFAPVLNYLRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDK---KRVYRV 136
            ||.|:|||||||||::: .::||||||||||||:..|:.|:||.|  ||...:|.:   |.||||
Zfish   131 YFGPILNYLRHGKLIINKNLAEEGVLEEAEFYNIASLVRLVKERI--RDNENRTSQGPVKHVYRV 193

  Fly   137 LQCREQELTQMISTLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKEC-GTTAGRELELNDRAK 199
            |||:|:|||||:||:||||:||||||:..: |||..:..|||||||:|. .:|.|..:|..::||
Zfish   194 LQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPTEKAK 258

  Fly   200 VLQQKGSRI 208
            :||::|||:
Zfish   259 ILQERGSRM 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 71/99 (72%)
BTB_2 24..112 CDD:280393 65/88 (74%)
kctd2NP_001038899.1 BTB 78..179 CDD:197585 73/102 (72%)
BTB_2 79..167 CDD:280393 65/87 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579013
Domainoid 1 1.000 141 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I3315
OMA 1 1.010 - - QHG48084
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm25396
orthoMCL 1 0.900 - - OOG6_106132
Panther 1 1.100 - - O PTHR14958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.