DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and kctd17

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_005156234.1 Gene:kctd17 / 568267 ZFINID:ZDB-GENE-130531-80 Length:315 Species:Danio rerio


Alignment Length:189 Identity:110/189 - (58%)
Similarity:133/189 - (70%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRH 86
            :||:||||||.||||:.||.::..|||.||.|:. ||.||.||||||:|||||.||.|:||||||
Zfish    82 KWVRLNVGGTVFLTTRQTLLKEQTSFLYRLCQQQ-DLHSDTDETGAYVIDRDPTYFGPILNYLRH 145

  Fly    87 GKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQR--PQTDKKRVYRVLQCREQELTQMI 148
            ||||.: .::||||||||||||:|.||.|:||.||.||.:  .|...|.|||||||:|:|||||:
Zfish   146 GKLVYNKELAEEGVLEEAEFYNITPLIKLIKERILERDSKATQQVPPKHVYRVLQCQEEELTQMV 210

  Fly   149 STLSDGWRFEQL------------------ISMQYTNYGPFENNEFLCVVSKECGTTAG 189
            ||:||||:|||:                  |...| :||..:..|||||||||..|:||
Zfish   211 STMSDGWKFEQVSVRACRKPRPGLLWTMVNIGSSY-SYGTEDQAEFLCVVSKELHTSAG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 68/99 (69%)
BTB_2 24..112 CDD:280393 60/88 (68%)
kctd17XP_005156234.1 BTB_2 84..172 CDD:308049 60/88 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579012
Domainoid 1 1.000 141 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I3315
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm25396
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.