DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and kctd12.2

DIOPT Version :10

Sequence 1:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001029191.1 Gene:kctd12.2 / 553403 ZFINID:ZDB-GENE-060117-4 Length:271 Species:Danio rerio


Alignment Length:98 Identity:33/98 - (33%)
Similarity:51/98 - (52%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRHGK 88
            ::|||||..::|..:||...|||.|..:..:........|..|.:.:|||...|..:|:|||...
Zfish    17 IELNVGGQVYVTRHSTLLSVPNSLLWTMFSQKKPAELTTDSKGRFFLDRDGFLFRYILDYLRDQT 81

  Fly    89 LVLDGVSEE--GVLEEAEFYNVTQLIALLKECI 119
            |||....:|  .:|:|||::.:..|...||..:
Zfish    82 LVLPDYFKEKASLLKEAEYFQLQDLAKRLKPAV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 30/83 (36%)
kctd12.2NP_001029191.1 BTB_POZ 13..112 CDD:453885 32/94 (34%)
H1_KCTD12 153..271 CDD:409028
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.