DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and KCTD9

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_060104.2 Gene:KCTD9 / 54793 HGNCID:22401 Length:389 Species:Homo sapiens


Alignment Length:250 Identity:76/250 - (30%)
Similarity:115/250 - (46%) Gaps:52/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KSPNVLKKQGTDQWVKLNVGGTYFLTTKTTL-SRDPNSFLSRLIQEDCDLISDRDETGAYLIDRD 73
            |.|..|....|| |:.|||||.||.||::|| :::|:|.|:.:.::.....:.:|..||:||||.
Human    78 KPPEGLLGFHTD-WLTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDRS 141

  Fly    74 PKYFAPVLNYLRHGKLVL-DGVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYRVL 137
            |:||.|:|||||||:|:: ||::..||||||.|:.:..||..|:..|  ::.:|..|...:.|..
Human   142 PEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSLIEHLEVAI--KNSQPPEDHSPISRKE 204

  Fly   138 QCREQELTQMISTL-SDGWRFE----QLISMQYTNYGPFEN-------NEFLCVVSKE------- 183
            ..|....|...|.| ..|..|.    ..:.::|.|: ...|       :..||..:.|       
Human   205 FVRFLLATPTKSELRCQGLNFSGADLSRLDLRYINF-KMANLSRCNLAHANLCCANLERADLSGS 268

  Fly   184 -------------CGTTAGRELEL--------------NDRAKVLQQKGSRILGI 211
                         |....|..|:|              ....|.:..:||::.||
Human   269 VLDCANLQGVKMLCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 47/100 (47%)
BTB_2 24..112 CDD:280393 42/89 (47%)
KCTD9NP_060104.2 KHA 2..66 CDD:340593
BTB_POZ_KCTD9 89..188 CDD:349677 47/99 (47%)
YjbI 168..378 CDD:224276 33/158 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D545341at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.