Sequence 1: | NP_001284786.1 | Gene: | inc / 31110 | FlyBaseID: | FBgn0025394 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060104.2 | Gene: | KCTD9 / 54793 | HGNCID: | 22401 | Length: | 389 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 76/250 - (30%) |
---|---|---|---|
Similarity: | 115/250 - (46%) | Gaps: | 52/250 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KSPNVLKKQGTDQWVKLNVGGTYFLTTKTTL-SRDPNSFLSRLIQEDCDLISDRDETGAYLIDRD 73
Fly 74 PKYFAPVLNYLRHGKLVL-DGVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYRVL 137
Fly 138 QCREQELTQMISTL-SDGWRFE----QLISMQYTNYGPFEN-------NEFLCVVSKE------- 183
Fly 184 -------------CGTTAGRELEL--------------NDRAKVLQQKGSRILGI 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inc | NP_001284786.1 | BTB | 23..122 | CDD:197585 | 47/100 (47%) |
BTB_2 | 24..112 | CDD:280393 | 42/89 (47%) | ||
KCTD9 | NP_060104.2 | KHA | 2..66 | CDD:340593 | |
BTB_POZ_KCTD9 | 89..188 | CDD:349677 | 47/99 (47%) | ||
YjbI | 168..378 | CDD:224276 | 33/158 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D545341at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |