DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and KCTD5

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_061865.1 Gene:KCTD5 / 54442 HGNCID:21423 Length:234 Species:Homo sapiens


Alignment Length:191 Identity:123/191 - (64%)
Similarity:151/191 - (79%) Gaps:4/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRH 86
            :||:|||||||||||:.||.|||.|||.||.|.|.||.||:||||||||||||.||.||||||||
Human    44 KWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRH 108

  Fly    87 GKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQR-PQTDKKRVYRVLQCREQELTQMIS 149
            ||||:: .::||||||||||||:|.||.|:|:.|..||.: .|...|.|||||||:|:|||||:|
Human   109 GKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVS 173

  Fly   150 TLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKEC-GTTAGRELELNDRAKVLQQKGSRI 208
            |:||||:||||:|:..: |||..:..|||||||||. .|..|...|.:::||:||::|||:
Human   174 TMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 73/99 (74%)
BTB_2 24..112 CDD:280393 67/88 (76%)
KCTD5NP_061865.1 BTB_POZ_KCTD5 40..151 CDD:349698 75/106 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..234 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145621
Domainoid 1 1.000 137 1.000 Domainoid score I4894
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10363
Inparanoid 1 1.050 237 1.000 Inparanoid score I3380
Isobase 1 0.950 - 0 Normalized mean entropy S2734
OMA 1 1.010 - - QHG48084
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm40345
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14958
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3727
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.850

Return to query results.
Submit another query.