DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and Kctd2

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_008766633.1 Gene:Kctd2 / 498024 RGDID:1566063 Length:263 Species:Rattus norvegicus


Alignment Length:197 Identity:119/197 - (60%)
Similarity:154/197 - (78%) Gaps:9/197 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRL-IQEDCDLISDRDETGAYLIDRDPKYFAPVLN 82
            |..:||:||||||||:||:.||.|:|.|||.|| .|||.:|.||:||||||||||||.||.|:||
  Rat    69 GAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILN 133

  Fly    83 YLRHGKLVL-DGVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDK---KRVYRVLQCREQE 143
            |||||||:: ..::||||||||||||:..|:.|:||.|  ||...:|.:   |.|||||||:|:|
  Rat   134 YLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERI--RDNENRTSQGPVKHVYRVLQCQEEE 196

  Fly   144 LTQMISTLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKEC-GTTAGRELELNDRAKVLQQKGS 206
            ||||:||:||||:||||||:..: |||..:..|||||||:|. .:|.|..:|.:::||:||::||
  Rat   197 LTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGS 261

  Fly   207 RI 208
            |:
  Rat   262 RM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 68/100 (68%)
BTB_2 24..112 CDD:280393 62/89 (70%)
Kctd2XP_008766633.1 BTB 73..175 CDD:197585 70/103 (68%)
BTB_2 74..163 CDD:280393 62/88 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339314
Domainoid 1 1.000 137 1.000 Domainoid score I4759
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I3274
OMA 1 1.010 - - QHG48084
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm44475
orthoMCL 1 0.900 - - OOG6_106132
Panther 1 1.100 - - O PTHR14958
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.