DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and Kctd17

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_006242038.2 Gene:Kctd17 / 300317 RGDID:1311154 Length:363 Species:Rattus norvegicus


Alignment Length:168 Identity:107/168 - (63%)
Similarity:132/168 - (78%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNY 83
            |..:||:||||||.||||:.||.|:..||||||.|.: :|.|||||||||||||||.||.|:||:
  Rat    28 GWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGE-ELQSDRDETGAYLIDRDPTYFGPILNF 91

  Fly    84 LRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQR-PQTDKKRVYRVLQCREQELTQ 146
            ||||||||| .::||||||||||||:..||.::|:.:..:|.. .|...|.|||||||:|:||||
  Rat    92 LRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQ 156

  Fly   147 MISTLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKE 183
            |:||:|||||||||:::..: |||..:..|||||||||
  Rat   157 MVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 67/99 (68%)
BTB_2 24..112 CDD:280393 63/88 (72%)
Kctd17XP_006242038.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339313
Domainoid 1 1.000 137 1.000 Domainoid score I4759
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I3274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm44475
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14958
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.