DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and Dcdc5

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_008760305.2 Gene:Dcdc5 / 295980 RGDID:1562221 Length:885 Species:Rattus norvegicus


Alignment Length:209 Identity:40/209 - (19%)
Similarity:73/209 - (34%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INSRKSPNVLKKQGTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLI 70
            :|:......||||   .|:|...|.....|.|..:                     |...|..:.
  Rat   653 LNAPWKSEKLKKQ---NWLKRAKGLAELDTMKHKV---------------------RQLKGRRVA 693

  Fly    71 DRDPKYFAPVLNYLRHGKLVLDGVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYR 135
            ...|....|..:.|:  .:|::|...|...||      |:|:.|:::...|..:..:...:|.. 
  Rat   694 ACQPAVMVPTGSPLQ--PVVVEGGWTEQTQEE------TKLVELIRQTEAHLSEGQELQSRRSL- 749

  Fly   136 VLQCREQELTQMISTLSDGWRFEQLISMQYTNYGPFENNEFLCV-----VSKECGTTAGRELELN 195
               ...|...:...:|....|.:::  ..|.|.|..|:..::|.     :..:|  ||  .|:::
  Rat   750 ---TEAQRAAESQHSLYQAPRVKRV--WAYQNGGRPEDGTYVCASAFPELLDDC--TA--RLKMS 805

  Fly   196 DRAKVLQQKGSRIL 209
            ..||.|......::
  Rat   806 HPAKTLYTSNGELI 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 18/98 (18%)
BTB_2 24..112 CDD:280393 15/87 (17%)
Dcdc5XP_008760305.2 Ubiquitin_like_fold 15..122 CDD:421700
RICIN <272..373 CDD:238092
DCX3_DCDC5 519..652 CDD:340678
Ubiquitin_like_fold 769..841 CDD:421700 12/57 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.