DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and Kctd5

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001099238.1 Gene:Kctd5 / 287109 RGDID:1304990 Length:234 Species:Rattus norvegicus


Alignment Length:197 Identity:124/197 - (62%)
Similarity:153/197 - (77%) Gaps:4/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KKQGTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPV 80
            :..|..:||:|||||||||||:.||.|||.|||.||.|.|.||.||:||||||||||||.||.||
  Rat    38 RPSGVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPV 102

  Fly    81 LNYLRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQR-PQTDKKRVYRVLQCREQE 143
            ||||||||||:: .::||||||||||||:|.||.|:|:.|..||.: .|...|.|||||||:|:|
  Rat   103 LNYLRHGKLVINRDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQMPVKHVYRVLQCQEEE 167

  Fly   144 LTQMISTLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKEC-GTTAGRELELNDRAKVLQQKGS 206
            ||||:||:||||:||||:|:..: |||..:..|||||||||. .|..|...|.:::||:||::||
  Rat   168 LTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTTSEPSEKAKILQERGS 232

  Fly   207 RI 208
            |:
  Rat   233 RM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 73/99 (74%)
BTB_2 24..112 CDD:280393 67/88 (76%)
Kctd5NP_001099238.1 BTB_POZ_KCTD5 40..151 CDD:349698 76/110 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..234 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339312
Domainoid 1 1.000 137 1.000 Domainoid score I4759
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10363
Inparanoid 1 1.050 239 1.000 Inparanoid score I3274
OMA 1 1.010 - - QHG48084
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 1 1.000 - - otm44475
orthoMCL 1 0.900 - - OOG6_106132
Panther 1 1.100 - - LDO PTHR14958
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.