DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and Kctd8

DIOPT Version :10

Sequence 1:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_780728.3 Gene:Kctd8 / 243043 MGIID:2443804 Length:476 Species:Mus musculus


Alignment Length:137 Identity:43/137 - (31%)
Similarity:64/137 - (46%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDC---------DLISDRDETGAYLIDRDPKYFAP 79
            |:|||||..::|..:||...|:|.|:.:.....         ||  .||....:.||||...|..
Mouse    46 VELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGDL--PRDSRARFFIDRDGFLFRY 108

  Fly    80 VLNYLRHGKLVLDG--VSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYRVLQCREQ 142
            ||:|||..:|.|..  ..:|.:|.||||:.:|.|:.||.         |:..|:..... :|.:.
Mouse   109 VLDYLRDKQLALPEHFPEKERLLREAEFFQLTDLVKLLS---------PKVTKQNSLND-ECCQS 163

  Fly   143 ELTQMIS 149
            :|...:|
Mouse   164 DLEDNVS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 33/92 (36%)
Kctd8NP_780728.3 BTB_POZ_KCTD8 41..150 CDD:349704 39/114 (34%)
H1_KCTD8 204..324 CDD:409029
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.