DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and ZC239.15

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_494481.2 Gene:ZC239.15 / 191125 WormBaseID:WBGene00022573 Length:232 Species:Caenorhabditis elegans


Alignment Length:162 Identity:51/162 - (31%)
Similarity:83/162 - (51%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRHGK 88
            |||:||||.|.|:::||::. |.|...:::.|..|  ..||:|:..|||.||.|..:||::|.|.
 Worm     5 VKLDVGGTIFKTSRSTLTKF-NGFFKTMLESDIGL--KIDESGSIFIDRSPKNFDLILNFMRDGD 66

  Fly    89 LVLDG--VSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYRVLQCREQELTQMISTL 151
            :||..  :..:.:|.||:||.:..||.|....|    :..:..|.:: |.::..||         
 Worm    67 VVLPNCELKLKELLVEAQFYLLDGLIELCNSKI----ELVEAPKIKL-RFIESDEQ--------- 117

  Fly   152 SDGWRFEQLISMQYTNYGPFENNEFLCVVSKE 183
                 |.|::::|..   |....|| |:|..:
 Worm   118 -----FLQILAVQQK---PMLIIEF-CMVGND 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 39/99 (39%)
BTB_2 24..112 CDD:280393 35/89 (39%)
ZC239.15NP_494481.2 BTB_2 5..95 CDD:366986 37/92 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2734
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.