DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and F32B4.5

DIOPT Version :10

Sequence 1:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001361860.1 Gene:F32B4.5 / 185191 WormBaseID:WBGene00009315 Length:219 Species:Caenorhabditis elegans


Alignment Length:35 Identity:13/35 - (37%)
Similarity:16/35 - (45%) Gaps:4/35 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDE 64
            |....||:.||.|.|.|    |:....|..||.|:
 Worm    11 GATISTTRATLQRAPQS----LLATSPDATSDSDD 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 13/35 (37%)
F32B4.5NP_001361860.1 H1_KCTD12-like 88..206 CDD:409026
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.