DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and F49H12.3

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_508383.1 Gene:F49H12.3 / 180521 WormBaseID:WBGene00018654 Length:146 Species:Caenorhabditis elegans


Alignment Length:139 Identity:48/139 - (34%)
Similarity:59/139 - (42%) Gaps:38/139 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLNVGGTYFLTTKTTLSRDP---NSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLR 85
            ::.|||||...|.|||...|.   ..|:||  .:.....||||  |||.:||||..|..||||.|
 Worm     7 IRFNVGGTPMATLKTTFPVDSIFHKWFVSR--TKASPFTSDRD--GAYFVDRDPFSFGVVLNYFR 67

  Fly    86 HGKLVLDGVSEEGVL-----------EEAEFYNVTQL----IALLKECILHRDQR---------- 125
            ..|.   |...|..|           :||:|:.:.||    |.:|:.|....|..          
 Worm    68 LRKA---GQLWEACLPKDPDRLAMLTQEADFFLLPQLRDQAICMLQLCSNKNDSNYINEMLAKST 129

  Fly   126 --PQ-TDKK 131
              || .|||
 Worm   130 SCPQGFDKK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 42/115 (37%)
BTB_2 24..112 CDD:280393 39/105 (37%)
F49H12.3NP_508383.1 BTB_POZ_KCTD-like 7..96 CDD:349625 36/95 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.