DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and H42K12.3

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_508240.1 Gene:H42K12.3 / 180474 WormBaseID:WBGene00019272 Length:522 Species:Caenorhabditis elegans


Alignment Length:208 Identity:38/208 - (18%)
Similarity:67/208 - (32%) Gaps:77/208 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YFLTTKTTL-SRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRHGKLVLDGVS 95
            :|:|...:| |.||..: ....:|:|        ..|...:|| |:..|:             |.
 Worm    33 FFVTDNASLQSADPIVY-KATSEEEC--------LSACTKNRD-KFDRPI-------------VC 74

  Fly    96 EEGVLEEAEFYNVTQLIALLKECILHRD--------QRPQTDKKRVYRVL--------QCREQEL 144
            .....:.|.|           .|.:|::        |...:..||.:..:        ||.:.:.
 Worm    75 HSFTYDHASF-----------SCTIHKEKSAPVGSAQIENSVGKRYFEKICLSHNIPQQCAQTQF 128

  Fly   145 TQMISTLSDGWRFEQLI------------------SMQYTNYGPFENNEFLCVVSKECGTT--AG 189
            .::..::..|:.....:                  |..|.    :|:.|  |:.:||...|  ||
 Worm   129 IRVDQSVLVGYAVNMTLTDSIESCAAQCVQEADCKSAMYF----YEDGE--CITNKESAMTKPAG 187

  Fly   190 RELELNDRAKVLQ 202
            ...|.||:....|
 Worm   188 FTKEENDKVIYFQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 17/90 (19%)
BTB_2 24..112 CDD:280393 16/80 (20%)
H42K12.3NP_508240.1 PAN_AP 28..113 CDD:214680 21/113 (19%)
PAN_1 127..203 CDD:278453 15/80 (19%)
TSP1 385..424 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.