DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and agns-1

DIOPT Version :10

Sequence 1:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_499312.2 Gene:agns-1 / 176468 WormBaseID:WBGene00008425 Length:238 Species:Caenorhabditis elegans


Alignment Length:96 Identity:37/96 - (38%)
Similarity:53/96 - (55%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRHGK 88
            |||:|||..|.||..||.:. :|.|..:...|..:  .::|.|:..||||.|:|..:||:||.|:
 Worm     7 VKLDVGGKIFKTTIFTLCKH-DSMLKTMFCTDVPV--TKNEEGSVFIDRDSKHFRLILNFLRDGQ 68

  Fly    89 LVLDGVSEE--GVLEEAEFYNVTQLIALLKE 117
            :.|.....|  .||.||.::.:..||.|..|
 Worm    69 IALPDSDREVREVLAEASYFLLDPLIELCGE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 33/83 (40%)
agns-1NP_499312.2 BTB_POZ 7..97 CDD:453885 35/92 (38%)

Return to query results.
Submit another query.