DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and F18A11.5

DIOPT Version :10

Sequence 1:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001254362.1 Gene:F18A11.5 / 174943 WormBaseID:WBGene00008932 Length:231 Species:Caenorhabditis elegans


Alignment Length:107 Identity:41/107 - (38%)
Similarity:60/107 - (56%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SRKSPNVLKKQGTD--QWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETG-AYL 69
            |:.|....::.|::  :.|.|||||..|.||..||:|..::.|:       .::|||.:|| ...
 Worm     4 SQNSMTFSQEGGSNLSERVLLNVGGKKFETTVATLTRVSDTVLA-------VMVSDRWKTGDEIF 61

  Fly    70 IDRDPKYFAPVLNYLRHGKLVL---DGVSEEGVLEEAEFYNV 108
            ||||||:|..||||||.|...:   |..:.:.:..||.|||:
 Worm    62 IDRDPKHFGKVLNYLRDGDHFVAPSDTEACDELKREAHFYNM 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 35/86 (41%)
F18A11.5NP_001254362.1 BTB_POZ 22..102 CDD:453885 36/86 (42%)

Return to query results.
Submit another query.