DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and ZC239.13

DIOPT Version :10

Sequence 1:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001254063.1 Gene:ZC239.13 / 173664 WormBaseID:WBGene00022571 Length:84 Species:Caenorhabditis elegans


Alignment Length:68 Identity:29/68 - (42%)
Similarity:42/68 - (61%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRHGK 88
            |||:||||.|.|:|.||.: .:|....:::....|  :.||:|...|||.||:|..:||::|.|.
 Worm     5 VKLDVGGTIFKTSKDTLMK-LDSIFKTMLESGTGL--ELDESGCIFIDRSPKHFNRILNFMRDGD 66

  Fly    89 LVL 91
            |.|
 Worm    67 LSL 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 29/68 (43%)
ZC239.13NP_001254063.1 BTB_POZ_KCTD-like 5..72 CDD:349625 29/68 (43%)

Return to query results.
Submit another query.