| Sequence 1: | NP_001284786.1 | Gene: | inc / 31110 | FlyBaseID: | FBgn0025394 | Length: | 211 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001104498.1 | Gene: | Kctd9 / 105440 | MGIID: | 2145579 | Length: | 389 | Species: | Mus musculus |
| Alignment Length: | 250 | Identity: | 75/250 - (30%) |
|---|---|---|---|
| Similarity: | 114/250 - (45%) | Gaps: | 52/250 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 KSPNVLKKQGTDQWVKLNVGGTYFLTTKTTL-SRDPNSFLSRLIQEDCDLISDRDETGAYLIDRD 73
Fly 74 PKYFAPVLNYLRHGKLVL-DGVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYRVL 137
Fly 138 QCREQELTQMISTL-SDGWRFE----QLISMQYTNYGPFEN-------NEFLCVVSKE------- 183
Fly 184 -------------CGTTAGRELEL--------------NDRAKVLQQKGSRILGI 211 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| inc | NP_001284786.1 | BTB | 23..122 | CDD:197585 | 47/100 (47%) |
| BTB_2 | 24..112 | CDD:280393 | 42/89 (47%) | ||
| Kctd9 | NP_001104498.1 | KHA | 2..64 | CDD:288667 | |
| BTB | 90..191 | CDD:197585 | 47/102 (46%) | ||
| BTB | 91..181 | CDD:295341 | 42/89 (47%) | ||
| Pentapeptide | 219..250 | CDD:279183 | 5/31 (16%) | ||
| Pentapeptide_4 | 239..310 | CDD:290330 | 9/71 (13%) | ||
| Pentapeptide | 243..280 | CDD:279183 | 4/36 (11%) | ||
| Pentapeptide | 303..342 | CDD:279183 | 4/20 (20%) | ||
| Pentapeptide_4 | 310..384 | CDD:290330 | 4/13 (31%) | ||
| Pentapeptide | 338..377 | CDD:279183 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D545341at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||