DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and kctd17

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_004913948.1 Gene:kctd17 / 101733823 XenbaseID:XB-GENE-6035411 Length:233 Species:Xenopus tropicalis


Alignment Length:175 Identity:99/175 - (56%)
Similarity:127/175 - (72%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KQGTDQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVL 81
            |:|  |||:|||||..|||||.||.|:|||||.||.||. .|:|::||:||:||||||.||..:|
 Frog    20 KEG--QWVRLNVGGKVFLTTKQTLCREPNSFLCRLCQES-QLLSEKDESGAFLIDRDPSYFGAIL 81

  Fly    82 NYLRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRVYRVLQCREQELT 145
            .|||||||::| .||.|||||||||||:..||.:::| .:...:..|..:|.|||||||:|.||.
 Frog    82 RYLRHGKLIIDKNVSIEGVLEEAEFYNIASLIQIIRE-KMEAAKVSQLQQKHVYRVLQCQEAELA 145

  Fly   146 QMISTLSDGWRFEQLISMQ----YTNYGPFENNEFLCVVSKECGT 186
            ||:|::||.|:||||:::.    |:..|   ..|||||||:|..|
 Frog   146 QMVSSMSDSWKFEQLVNVGSPYCYSTEG---QAEFLCVVSRELQT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 63/99 (64%)
BTB_2 24..112 CDD:280393 59/88 (67%)
kctd17XP_004913948.1 BTB_POZ_KCTD2-like 24..107 CDD:349671 57/83 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 1 1.000 - - FOG0001778
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.