DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and kctd2

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_004918529.1 Gene:kctd2 / 100485398 XenbaseID:XB-GENE-993892 Length:245 Species:Xenopus tropicalis


Alignment Length:209 Identity:126/209 - (60%)
Similarity:160/209 - (76%) Gaps:10/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SRKSPNVLKKQGT--DQWVKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLI 70
            |.:||...:..|.  .:||:|||||||||:||.||.|||.|||.||.|||.||.||:||||||||
 Frog    39 SPRSPGPQEPSGRTGSKWVRLNVGGTYFLSTKQTLCRDPKSFLYRLCQEDPDLDSDKDETGAYLI 103

  Fly    71 DRDPKYFAPVLNYLRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDK---K 131
            ||||.||.|:|||||||||:|: .::||||||||||||:..|:.|:||.|  ||...:|.:   |
 Frog   104 DRDPTYFGPILNYLRHGKLILNKELAEEGVLEEAEFYNIASLVRLVKERI--RDNENRTSQGPVK 166

  Fly   132 RVYRVLQCREQELTQMISTLSDGWRFEQLISMQYT-NYGPFENNEFLCVVSKEC-GTTAGRELEL 194
            .|||||||:|:|||||:||:||||:||||||:..: |||..:..|||||||:|. .:|.|..:|.
 Frog   167 HVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGLVIEP 231

  Fly   195 NDRAKVLQQKGSRI 208
            :::||:||::|||:
 Frog   232 SEKAKILQERGSRM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 72/99 (73%)
BTB_2 24..112 CDD:280393 66/88 (75%)
kctd2XP_004918529.1 BTB_POZ_KCTD2 55..159 CDD:349697 74/105 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1333587at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14958
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.