DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inc and kctd9

DIOPT Version :9

Sequence 1:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001120488.1 Gene:kctd9 / 100145607 XenbaseID:XB-GENE-976411 Length:389 Species:Xenopus tropicalis


Alignment Length:132 Identity:60/132 - (45%)
Similarity:86/132 - (65%) Gaps:5/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INSRKSPNVLKKQGTDQWVKLNVGGTYFLTTKTTL-SRDPNSFLSRLIQEDCDLISDRDETGAYL 69
            :||...|..|....|| |:.|||||.||.||::|| |::|:|.||.:..:.....:.:|.|||:|
 Frog    74 MNSFDIPEQLTGGHTD-WLTLNVGGRYFTTTRSTLVSKEPDSMLSHMFSDRDAWGNKKDHTGAFL 137

  Fly    70 IDRDPKYFAPVLNYLRHGKLVL-DGVSEEGVLEEAEFYNVTQLIALLKECILHRDQRPQTDKKRV 133
            |||.|:||.|:|||||||:|:: |||:..||||||:|:.:..||..|:..|  ::.:|..|...:
 Frog   138 IDRSPEYFEPILNYLRHGQLIVNDGVNLLGVLEEAKFFGIDSLIEHLELAI--KNSQPADDHSPI 200

  Fly   134 YR 135
            .|
 Frog   201 SR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
incNP_001284786.1 BTB 23..122 CDD:197585 51/100 (51%)
BTB_2 24..112 CDD:280393 46/89 (52%)
kctd9NP_001120488.1 KHA 2..64 CDD:288667
BTB 90..191 CDD:197585 51/102 (50%)
BTB 91..181 CDD:295341 46/89 (52%)
Pentapeptide 219..251 CDD:279183
Pentapeptide_4 240..325 CDD:290330
Pentapeptide 243..280 CDD:279183
Pentapeptide 303..342 CDD:279183
Pentapeptide_4 310..384 CDD:290330
Pentapeptide 338..377 CDD:279183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D545341at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.