DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14795 and LOC4576158

DIOPT Version :10

Sequence 1:NP_569925.2 Gene:CG14795 / 31109 FlyBaseID:FBgn0025393 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_001237335.1 Gene:LOC4576158 / 4576158 VectorBaseID:AGAMI1_009986 Length:149 Species:Anopheles gambiae


Alignment Length:85 Identity:36/85 - (42%)
Similarity:43/85 - (50%) Gaps:18/85 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLVLVCASVSASPMLYKLNPEEKYEADLVPVSSTVIPLTVLEVSYGAGGKPS----------- 61
            :|.|.|:..|.:|:.|.||....||||.|.||||||||||....||.||..|||           
Mosquito    38 ILQLCLLAGSANATSMYYKKVSGEKYEPDWVPVSSTVIPLVERVVSVGARTKPSTGADGSQHPGA 102

  Fly    62 -------EEYKAAYLRKLRK 74
                   |.||.||::.:.|
Mosquito   103 ARLQSADESYKRAYVKHISK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14795NP_569925.2 None
LOC4576158XP_001237335.1 PRK13351 <3..>26 CDD:481252
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.