DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdar2 and spp-22

DIOPT Version :9

Sequence 1:NP_001014714.1 Gene:Nmdar2 / 31107 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster
Sequence 2:NP_001025004.2 Gene:spp-22 / 3565459 WormBaseID:WBGene00044283 Length:149 Species:Caenorhabditis elegans


Alignment Length:113 Identity:27/113 - (23%)
Similarity:45/113 - (39%) Gaps:28/113 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 LMELVN----SEARVMLLYA--TQTEAITILRAAEEMKLTGENYVWVVSQSVIEKKDAHSQFPVG 357
            :::::|    |.:...|.||  .:|.|..:.:  :.|..|.|.||..|:|......|...:   .
 Worm     1 MVQIINRILISVSIFYLCYAHPYKTNAKDLEK--DRMLTTNEYYVEKVNQMAGISCDLCMR---A 60

  Fly   358 MLGVHFD-------------TSSAALMNE----ISNAIKIYSYGVEAY 388
            :.||::|             ....||.:|    ||..|:..:..||.|
 Worm    61 VYGVNYDFIQLKKDFIEMIRLDCEALFHERPEDISECIRFLTTKVEKY 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373 27/113 (24%)
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436
Lig_chan 665..928 CDD:278489
spp-22NP_001025004.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.