DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdar2 and Ir7g

DIOPT Version :9

Sequence 1:NP_001014714.1 Gene:Nmdar2 / 31107 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster
Sequence 2:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster


Alignment Length:295 Identity:64/295 - (21%)
Similarity:102/295 - (34%) Gaps:89/295 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NIGLIAPHTNFGKREYLRSINNAVTGLTKTRGAKLTFLKDYSFEQKNIHFDMMSLTPSPTAILST 166
            |:..:.||           .:|.|.|........||.|:.:||               |...|:.
  Fly   299 NLTPVFPH-----------YSNRVVGCLLLNAHNLTSLEIWSF---------------PFQALTW 337

  Fly   167 LCK--EFLRVNVSAILYMMNNEQFGHSTASAQYFLQLAGY---LGIPVISWNADNSGLERRASQS 226
            :|.  .||.::..|:|: ..        |..:..|.||.|   ||:|:           ....:.
  Fly   338 ICLVFSFLSISCLALLHXRG--------AGDRLALVLAVYAASLGLPI-----------DPPERP 383

  Fly   227 TLQLQLAP------SIEHQSAAMLSILERYKWHQFSVVTSQIAGHDDF--------VQAVRERVA 277
            :|||..|.      .:....:|:|..:.||..||......|...|.|:        :|.:|| |.
  Fly   384 SLQLLFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDLRE-VP 447

  Fly   278 EMQEHFKFTILNSIVVT--------RTSDLMELVNSEARVMLLYATQTEAITILRAAEEMKLTGE 334
            .:|:   ...|.|::||        ||.|...|........|.:...::. .:|...:.....|.
  Fly   448 SLQD---LLGLKSVIVTSEREEEVLRTLDRCTLREGAGSHPLFFGLISQD-ALLHLTQRGHRAGA 508

  Fly   335 NYVWVVSQSVIEKKDA-----HSQFPVGMLGVHFD 364
            .:  ::.|.|:|::.|     ||.     |..|.|
  Fly   509 YH--IIPQDVLEQQLAIYLQKHSH-----LASHLD 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373 64/295 (22%)
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436
Lig_chan 665..928 CDD:278489
Ir7gNP_001368933.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.