DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdar2 and Ir41a

DIOPT Version :9

Sequence 1:NP_001014714.1 Gene:Nmdar2 / 31107 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster
Sequence 2:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster


Alignment Length:487 Identity:96/487 - (19%)
Similarity:164/487 - (33%) Gaps:143/487 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 HEMAADI-DVGQAHRNESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTL-ENGKWNGLI 604
            |.|:.:. |:|.:..::.......|....::..|.|:...|.::.......||.: .|...:|.:
  Fly   228 HNMSTNAQDMGVSGESDFKNVYIDGTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDGAL 292

  Fly   605 ADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVG 669
            ..|:|||.|:.:.::....|....:|.|...:.:||..:|.....:.|....||||....|..:.
  Fly   293 GMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAAIL 357

  Fly   670 IVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTP-YR--------------FSLF-------RT 712
            :.....||.::..::      .:..||     |.| ||              |.||       :.
  Fly   358 LCLCAEATGLVLAYK------SEQALY-----VLPGYREGWWTCTSFGVCTTFKLFISQSGNSKA 411

  Fly   713 YWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFS------ 771
            |.|...||..|..       .....:|:::.......|.|.:.:.||..:||..||...      
  Fly   412 YSLTVRVLLFACF-------LNDLIITSIYGGGLASILTIPSMDEAADTVTRLRFHRLQWAANSE 469

  Fly   772 ------GLNDSRLV-------HPFSH------------KPSFKFGTIPYSHTDSTIHKYFNVMHN 811
                  ..:|..||       |.:|.            :..|....:|:.|.         .:.|
  Fly   470 AWVSAIRASDEALVKDILYNFHIYSDDELLRLAQDQHMRIGFTVERLPFGHF---------AIGN 525

  Fly   812 YMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDC-----------------RLMT-V 858
            |:          |..|:               |.||...:|.                 :|.| :
  Fly   526 YL----------GPQAI---------------DQLVIMKDDIYFQYTVAFVPRLWPLLDKLNTLI 565

  Fly   859 GSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQ 923
            .||:: :|:       .||   :..|::....|..:::..:..||||...|..      ||.:..
  Fly   566 YSWHS-SGF-------DKY---WEYRVVADNLNLKIQQQVQETMTGTKDIGPV------PLGMSN 613

  Fly   924 FLSAFLLLMAGILLAALLLLLEHVYFKYIRKR 955
            |....::.:.|..:|.|..||| :...||.|:
  Fly   614 FAGFIIVWILGSAIATLTFLLE-LSLTYILKQ 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436 83/438 (19%)
Lig_chan 665..928 CDD:278489 59/333 (18%)
Ir41aNP_995744.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.