DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and RPS0B

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_013149.1 Gene:RPS0B / 850737 SGDID:S000004038 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:139/239 - (58%)
Similarity:172/239 - (71%) Gaps:3/239 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDI 74
            |..:|...:|.|.||||:.||....|.||:..|.|||:::|:|||||||.||||.|.||.||.|:
Yeast     9 LTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDV 73

  Fly    75 FVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASY 139
            ..||||..|||||||||.:|..||||||||||:|||.|..:|:||||::||||..|.|.|.||||
Yeast    74 VAISSRTYGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRLDAQAIKEASY 138

  Fly   140 VNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGT-ISRSVEWPVVVDLFF 203
            |||||||.|:.|||..::|:||||||:..|||||:|:|||||||||||. :.|:..|.::.||:|
Yeast   139 VNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYF 203

  Fly   204 YRDPEEAEK--EEAAAKELLPPPKIEEAVDHPVEETTNWADEVA 245
            ||:|||.|:  |||||.|.....:::|.|.....|.|.||:|.|
Yeast   204 YRNPEEVEQVAEEAAAAEEGEEEEVKEEVTEGQAEATEWAEENA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 139/239 (58%)
RPS0BNP_013149.1 PTZ00254 1..252 CDD:240331 139/239 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345652
Domainoid 1 1.000 127 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68249
Inparanoid 1 1.050 277 1.000 Inparanoid score I574
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53661
OrthoFinder 1 1.000 - - FOG0003206
OrthoInspector 1 1.000 - - otm46816
orthoMCL 1 0.900 - - OOG6_100806
Panther 1 1.100 - - O PTHR11489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2274
SonicParanoid 1 1.000 - - X2156
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.