DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and RPSAb

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_850515.1 Gene:RPSAb / 819637 AraportID:AT3G04770 Length:332 Species:Arabidopsis thaliana


Alignment Length:193 Identity:122/193 - (63%)
Similarity:152/193 - (78%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPS 72
            :|.||.||..||.|..|||::|.|:|||:||:|||.||:.|:||||||:|||:|||.||||:||.
plant    13 VSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVAIENPK 77

  Fly    73 DIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEA 137
            ||.|.|:||.|||||||||:||....||||.|||.||||:|.:|.|||||::|||.||||||.|.
plant    78 DIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDPRTDHQPIKEG 142

  Fly   138 SYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVD 200
            :..|||.|||.:||||:.::||.||.|||..||||.::|||||.||::||||..:.:|.|:|:
plant   143 ALGNIPTIAFCDTDSPMGFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTILAAQKWDVMVN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 122/193 (63%)
RPSAbNP_850515.1 uS2_euk_arch 15..204 CDD:273394 120/188 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 137 1.000 Domainoid score I1583
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68249
Inparanoid 1 1.050 283 1.000 Inparanoid score I865
OMA 1 1.010 - - QHG53661
OrthoDB 1 1.010 - - D1129610at2759
OrthoFinder 1 1.000 - - FOG0003206
OrthoInspector 1 1.000 - - otm2797
orthoMCL 1 0.900 - - OOG6_100806
Panther 1 1.100 - - O PTHR11489
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.