DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and zgc:110181

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001017838.1 Gene:zgc:110181 / 550536 ZFINID:ZDB-GENE-050417-382 Length:295 Species:Danio rerio


Alignment Length:280 Identity:170/280 - (60%)
Similarity:197/280 - (70%) Gaps:19/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAI 65
            |||.   |:|.|.||.|||.|.||:||||.:|||.||||||..|||:|:||.||||||.||||||
Zfish     1 MSGA---LALTEPDILKMLAAKTHIGSENSDFQMLQYVYKRCIDGVHIINLKKTWEKLVLAARAI 62

  Fly    66 VAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTD 130
            |||:|||::|.||:|..|||||||::|||..|||||||||||||||||.||||||||||.||..|
Zfish    63 VAIENPSEVFAISTRQQGQRAVLKYSKYTGATPIAGRFTPGAFTNQIQAAFREPRLLVVADPLAD 127

  Fly   131 HQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEW 195
            ||.|:||||||||||||.:.||||||:|||||||.|:.||:|||:|.|.|||||||..|||...|
Zfish   128 HQSIVEASYVNIPVIAFCDVDSPLRYVDIAIPCNTKAPHSLGLMFWFLTREVLRLRAMISRDTPW 192

  Fly   196 PVVVDLFFYRDPEEAEKEEAAAKELL---PPPKIEEAVDHPVEE-------TTNWADE------V 244
            .::.|:||||.||:.:|||.|.:|.|   |...||.....|:.|       .|:||||      .
Zfish   193 EIMPDMFFYRAPEDVDKEEQAKQEALAAMPVRPIEADYSAPIAEDWSTEVAPTSWADEATDFAQA 257

  Fly   245 AAETVGGVEDWNEDTVKTSW 264
            |.......|.|:.:.|...|
Zfish   258 APVAPAAPEQWSAEPVTDDW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 166/261 (64%)
zgc:110181NP_001017838.1 PTZ00254 1..239 CDD:240331 160/240 (67%)
RPS2 8..203 CDD:294223 141/194 (73%)
40S_SA_C 199..288 CDD:292740 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.