DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and MRPS2

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001358330.1 Gene:MRPS2 / 51116 HGNCID:14495 Length:296 Species:Homo sapiens


Alignment Length:200 Identity:48/200 - (24%)
Similarity:82/200 - (41%) Gaps:28/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DILSLKE-DDITKMLVATTHLGSE---NVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAAR--A 64
            |..::|| ..:..:..|..|||.:   ...| ||.|::..|.|. :|::|.:|...||||..  |
Human    71 DFFNVKELFSVRSLFDARVHLGHKAGCRHRF-MEPYIFGSRLDH-DIIDLEQTATHLQLALNFTA 133

  Fly    65 IVAIDNPSDIFVISSRPIG---QRAVLKFAKYTDTTPIAGRFTPGAFTNQ---IQPAFREPRLLV 123
            .:|......:|:..:|...   :.......:|..|....|    |..||.   ..|..|.|.|::
Human   134 HMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRG----GMLTNARLLFGPTVRLPDLII 194

  Fly   124 -------VTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLARE 181
                   :.:|   |..:.:|:.:|||.:...:|:.....|...:|.|:.|..::.|...|....
Human   195 FLHTLNNIFEP---HVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTA 256

  Fly   182 VLRLR 186
            :.|.:
Human   257 ITRAK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 48/199 (24%)
MRPS2NP_001358330.1 RPS2 84..259 CDD:100106 44/183 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..296
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.