DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and RPSA

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001291217.1 Gene:RPSA / 3921 HGNCID:6502 Length:300 Species:Homo sapiens


Alignment Length:287 Identity:173/287 - (60%)
Similarity:202/287 - (70%) Gaps:25/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAI 65
            |||.||:|.:||:|:.|.|.|.||||..|::||||||:|||::||:.|:||.:|||||.||||||
Human     1 MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAI 65

  Fly    66 VAIDNPSDIFVISSRPIGQ-----RAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVT 125
            |||:||:|:.|||||..||     |||||||..|..||||||||||.||||||.|||||||||||
Human    66 VAIENPADVSVISSRNTGQVCGTVRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVT 130

  Fly   126 DPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTIS 190
            ||..||||:.||||||:|.||..||||||||:|||||||||.|||:|||||:|||||||:|||||
Human   131 DPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTIS 195

  Fly   191 RSVEWPVVVDLFFYRDPEEAEKEEAAAKE------------LLPPPKIEEAVDHPVEETTNWADE 243
            |...|.|:.||:|||||||.||||.||.|            ..|.|  |.....|  |..:|::.
Human   196 REHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAP--EFTATQP--EVADWSEG 256

  Fly   244 VAAETVG----GVEDWNEDTVKTSWGS 266
            |...:|.    ..|||:.......|.:
Human   257 VQVPSVPIQQFPTEDWSAQPATEDWSA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 168/262 (64%)
RPSANP_001291217.1 PTZ00254 1..255 CDD:240331 167/257 (65%)
Laminin-binding 166..185 15/18 (83%)
Laminin-binding 210..234 12/23 (52%)
[DE]-W-[ST] 1 235..237 0/1 (0%)
Laminin-binding 247..300 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..300 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157221
Domainoid 1 1.000 139 1.000 Domainoid score I4810
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68249
Inparanoid 1 1.050 342 1.000 Inparanoid score I2354
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53661
OrthoDB 1 1.010 - - D1129610at2759
OrthoFinder 1 1.000 - - FOG0003206
OrthoInspector 1 1.000 - - oto90151
orthoMCL 1 0.900 - - OOG6_100806
Panther 1 1.100 - - LDO PTHR11489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2274
SonicParanoid 1 1.000 - - X2156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.