DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and RPSAP58

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001342212.1 Gene:RPSAP58 / 388524 HGNCID:36809 Length:295 Species:Homo sapiens


Alignment Length:282 Identity:171/282 - (60%)
Similarity:200/282 - (70%) Gaps:20/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAI 65
            |||.||:|.:||:|:.|.|.|.||||..|::||||.|:|||::||:.|:||.:|||||.||||||
Human     1 MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEHYIYKRKSDGIYIINLKRTWEKLLLAARAI 65

  Fly    66 VAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTD 130
            |||:||:|:.|||||..|||||||||..|..||||||||||.||||||.||.||||||||||..|
Human    66 VAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFWEPRLLVVTDPRAD 130

  Fly   131 HQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEW 195
            |||:.||||||:|.||..||||||||:|||||||||.|||:|||||:|||||||:||||||...|
Human   131 HQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPW 195

  Fly   196 PVVVDLFFYRDPEEAEKEEAAAKE------------LLPPPKIEEAVDHPVEETTNWADEVAAET 248
            .|:.||:|||||||.||||.||.|            ..|.|  |.....|  |..:|::.|...:
Human   196 EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPSP--EFTATQP--EVADWSEGVQVPS 256

  Fly   249 VG----GVEDWNEDTVKTSWGS 266
            |.    ..|||:.......|.:
Human   257 VPIQQFPTEDWSAQPATEDWSA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 166/257 (65%)
RPSAP58NP_001342212.1 PTZ00254 1..250 CDD:240331 165/252 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129610at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.