DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and Mrps2

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006233894.1 Gene:Mrps2 / 362094 RGDID:1309116 Length:300 Species:Rattus norvegicus


Alignment Length:243 Identity:64/243 - (26%)
Similarity:97/243 - (39%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DILSLKE-DDITKMLVATTHLGSE---NVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAAR--A 64
            |..::|| ..:..:..|..|||.:   ...| ||.|::..|. |.:|::|.:|...||||..  |
  Rat    77 DFFNVKELFSVKSLFEARVHLGHKAGCRHRF-MEPYIFGNRL-GQDIIDLDQTALNLQLALNFTA 139

  Fly    65 IVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIA-GR------FTPGAFTNQ---IQPAFREP 119
            .||......:||..:|        :|:...:||..| |.      |..|..||.   ..|..|.|
  Rat   140 HVAYRKGIILFVSRNR--------QFSHLIETTAQACGEYAHTRYFKGGLLTNAQLLFGPTVRLP 196

  Fly   120 RLLV----VTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAR 180
            .|:|    :.:....|..:.:|:.:|||.:...:|:.....|...||.|:.|..:|.|...|   
  Rat   197 DLIVFLHTLNNVFESHVAVRDAAKMNIPTVGIVDTNCNPCLITYPIPGNDDSPQAIQLFCKL--- 258

  Fly   181 EVLRLRGTISRSVEWPVVVDLFFYRDPEEAEKEEAAAKELLPPPKIEE 228
                .|.||:|:.|                ::.:..|...|..||..|
  Rat   259 ----FRTTINRAKE----------------KRRQMEALHRLQSPKGSE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 64/243 (26%)
Mrps2XP_006233894.1 RPS2 90..265 CDD:100106 54/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.