DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and mRpS2

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster


Alignment Length:179 Identity:41/179 - (22%)
Similarity:73/179 - (40%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ATTHLGSE--NVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSR--- 80
            |..|.|.:  :::.:|..|::..|. |..|.:|.||...|:.|......|.....|.:..:|   
  Fly    66 ARVHYGHKEGSLDDRMRPYLFGSRL-GHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNRNAM 129

  Fly    81 --PIGQRAVLKFAKYTDTTPIAGRF-TPGAFTN---QIQPAFREPRLLVVTDPNTD----HQPIM 135
              .:.:|...:..:::.|     || ..|.|||   |.....|.|.|.:..:...:    |..:.
  Fly   130 NSHLVERKAQEAGEFSHT-----RFWRGGIFTNANVQFDAVTRLPDLCIFLNTQNNVMAQHTAVR 189

  Fly   136 EASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLR 184
            :|:.:.||.|...:::.....|...:|.|:.|..::.|...|....:||
  Fly   190 DAAKMAIPTIGIVDSNCNPNLITYPVPGNDDSPAAVELYCNLFKEAILR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 41/179 (23%)
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.