DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sta and rps001

DIOPT Version :9

Sequence 1:NP_001284785.1 Gene:sta / 31106 FlyBaseID:FBgn0003517 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_596140.1 Gene:rps001 / 2541144 PomBaseID:SPBC685.06 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:152/275 - (55%)
Similarity:191/275 - (69%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVA 67
            |..:||:..::||.::|.|..|:||:|:..:|:.||:|||:|||:|||||||||||.||||.|..
pombe     5 GRPNILNATDEDIKQLLAANCHIGSKNLEVRMDNYVWKRRSDGVHILNLGKTWEKLVLAARVIAT 69

  Fly    68 IDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQ 132
            |:||:|:.|:|:|..|.|||||||.:|..|.||||||||.|||.|...:|||||:|||||..|.|
pombe    70 IENPADVCVVSTRTYGHRAVLKFAAHTGATAIAGRFTPGNFTNYITRTYREPRLIVVTDPRADAQ 134

  Fly   133 PIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPV 197
            .|.|||:|||||||..:|||.|.::|||||.|||...||||:|:||||||||:|||:|||..|.|
pombe   135 AIKEASFVNIPVIALCDTDSILNHVDIAIPTNNKGRKSIGLIWYLLAREVLRVRGTLSRSAPWDV 199

  Fly   198 VVDLFFYRDPEEAEKEE-------AAAKELLPPPKIEEAVDHPVEETTNWA------DEVAAETV 249
            :.||:|||||||.|:||       |||:|    .::||||.....|.|:.|      :.:||.|.
pombe   200 MPDLYFYRDPEEVEREEEAKKAAAAAAEE----AQVEEAVAAAEFEITDSAAGSVDPNVLAAATA 260

  Fly   250 G--------GVEDWN 256
            |        |..|||
pombe   261 GQVGENTWEGAGDWN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
staNP_001284785.1 PTZ00254 1..247 CDD:240331 145/256 (57%)
rps001NP_596140.1 PTZ00254 7..209 CDD:240331 125/201 (62%)
RPS2 13..208 CDD:294223 122/194 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 131 1.000 Domainoid score I1316
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68249
Inparanoid 1 1.050 280 1.000 Inparanoid score I674
OMA 1 1.010 - - QHG53661
OrthoFinder 1 1.000 - - FOG0003206
OrthoInspector 1 1.000 - - otm47270
orthoMCL 1 0.900 - - OOG6_100806
Panther 1 1.100 - - O PTHR11489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2274
SonicParanoid 1 1.000 - - X2156
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.