DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and PIB1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_010599.1 Gene:PIB1 / 851908 SGDID:S000002721 Length:286 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:56/203 - (27%)
Similarity:83/203 - (40%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKAL-- 201
            |:...|:.|.|..|.:|..|..| ||.|:|:.||||||.||.:.|:.|:.......::...||  
Yeast     4 KEDCINNLARWQADEEAHSCFQC-KTNFSFLVRRHHCRCCGRIFCSSCTENFVNYNKKRVHALQK 67

  Fly   202 ----------RVCDACYERLKHVPSSLGS-GEDSAAATGAASGNKLNTTAGDSSNDEDSD----- 250
                      |.|:.||:.|.|:...:.| ..|...:..:...|.|..:|.||:.|||::     
Yeast    68 KNSDVESPPYRTCNECYDNLLHLNLLVSSTNRDVRLSQTSVPPNALALSAPDSNTDEDAEILEDS 132

  Fly   251 ---------EETASPGGESH-------DEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVT 299
                     .|.:|...|.|       |..:|..:......|||.......:...|.:.:|  ..
Yeast   133 VDQSGTACRSEESSQNEEDHFCPICNSDLTQFPDEEETRKHVEDCIQRAENAQQHTNTSDA--AD 195

  Fly   300 PSVQSSPA 307
            .||:.|||
Yeast   196 DSVKESPA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 23/71 (32%)
PIB1NP_010599.1 FYVE 12..89 CDD:214499 27/77 (35%)
RNF220 94..>198 CDD:406370 21/105 (20%)
mRING-CH-C4HC2H_ZNRF 224..260 CDD:319403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I1698
Isobase 1 0.950 - 0.864974 Normalized mean entropy S1591
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100071
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 1 1.000 - - X3637
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.