Sequence 1: | NP_001284784.1 | Gene: | rush / 31105 | FlyBaseID: | FBgn0025381 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010599.1 | Gene: | PIB1 / 851908 | SGDID: | S000002721 | Length: | 286 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 203 | Identity: | 56/203 - (27%) |
---|---|---|---|
Similarity: | 83/203 - (40%) | Gaps: | 37/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 KKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKAL-- 201
Fly 202 ----------RVCDACYERLKHVPSSLGS-GEDSAAATGAASGNKLNTTAGDSSNDEDSD----- 250
Fly 251 ---------EETASPGGESH-------DEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVT 299
Fly 300 PSVQSSPA 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rush | NP_001284784.1 | PH_Phafin2-like | 7..129 | CDD:269927 | |
PH | 39..131 | CDD:278594 | |||
FYVE_PKHF | 148..208 | CDD:277257 | 23/71 (32%) | ||
PIB1 | NP_010599.1 | FYVE | 12..89 | CDD:214499 | 27/77 (35%) |
RNF220 | 94..>198 | CDD:406370 | 21/105 (20%) | ||
mRING-CH-C4HC2H_ZNRF | 224..260 | CDD:319403 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1729 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 70 | 1.000 | Inparanoid score | I1698 |
Isobase | 1 | 0.950 | - | 0.864974 | Normalized mean entropy | S1591 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto100071 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2928 |
SonicParanoid | 1 | 1.000 | - | - | X3637 | |
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.840 |