DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and AT1G20110

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_564103.1 Gene:AT1G20110 / 838600 AraportID:AT1G20110 Length:601 Species:Arabidopsis thaliana


Alignment Length:154 Identity:46/154 - (29%)
Similarity:61/154 - (39%) Gaps:42/154 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 TSTEKQ---EWMAHINKCVEDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCR 176
            |:.:|:   :||..|             |||......||||...|.|..|......|| ||||||
plant   428 TAEKKKGLGDWMNII-------------KPVNEEKDHWVPDEAVSKCTSCGSDFGAFI-RRHHCR 478

  Fly   177 NCGAVVCAGCSAKKF-LLPQQSTKALRVCDACY----ERLKHVPS------SLGSGED------- 223
            |||.|.|..|:..:. |..:.:...:||||.|.    :||.:...      ||.|.||       
plant   479 NCGDVFCDKCTQGRIALTAEDNAPQVRVCDRCMAEVSQRLSNAKETTGRNVSLQSHEDLARKLQE 543

  Fly   224 -------SAAATGAASGNKLNTTA 240
                   |::.....||.::...|
plant   544 EMERNRKSSSGLREGSGRRMKEVA 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 5/16 (31%)
PH 39..131 CDD:278594 5/18 (28%)
FYVE_PKHF 148..208 CDD:277257 26/60 (43%)
AT1G20110NP_564103.1 PTB 297..>363 CDD:269911
FYVE 449..515 CDD:214499 27/66 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.