DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and FAB1B

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001319548.1 Gene:FAB1B / 820647 AraportID:AT3G14270 Length:1791 Species:Arabidopsis thaliana


Alignment Length:109 Identity:39/109 - (35%)
Similarity:55/109 - (50%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 WVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKK-------FLLPQQSTKALRVCDA 206
            |:||....||..| ..|||.|.||||||:||.|.|..|:|..       ...|::..:.:|||:.
plant    36 WMPDQSCRVCYEC-DCQFTLINRRHHCRHCGRVFCGKCTANSIPFAPSDLRTPREDWERIRVCNY 99

  Fly   207 CYERLK------HVPSSLGSGEDSAAATGAASGNKLNTTAGDSS 244
            |:.:.:      || |::.....|.:.|...| :|.:|||..||
plant   100 CFRQWEQGDGGPHV-SNITELSTSPSETSLLS-SKTSTTANSSS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 26/65 (40%)
FAB1BNP_001319548.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.