DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and PLEKHF2

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_078889.1 Gene:PLEKHF2 / 79666 HGNCID:20757 Length:249 Species:Homo sapiens


Alignment Length:256 Identity:160/256 - (62%)
Similarity:191/256 - (74%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYG 65
            |||||.|||||||||:.||||||::|.||.:.||||:|||||||:|||:||:|||||||||||||
Human     1 MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYG 65

  Fly    66 NIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV 130
            ||||.|||||||||:|||.|:::||.|....||||.|:|.||||.|:|||:|||.|||.||||||
Human    66 NIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCV 130

  Fly   131 EDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQ 195
            .|||.||||.|...||||||||::|:|||.|:|.:||.:.||||||.||.|||..||.|:||||.
Human   131 TDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPS 195

  Fly   196 QSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAAS---GNKLNTTAGDSSNDEDSDEET 253
            ||:|.:|:||.||:.|        |..|.|....|.|   ...|.:...|.|:|:|.|:.:
Human   196 QSSKPVRICDFCYDLL--------SAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 90/121 (74%)
PH 39..131 CDD:278594 69/91 (76%)
FYVE_PKHF 148..208 CDD:277257 37/59 (63%)
PLEKHF2NP_078889.1 PH_Phafin2-like 7..129 CDD:269927 90/121 (74%)
FYVE_PKHF2 148..211 CDD:277294 39/62 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..249 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158266
Domainoid 1 1.000 152 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11620
Inparanoid 1 1.050 333 1.000 Inparanoid score I2426
Isobase 1 0.950 - 0.864974 Normalized mean entropy S1591
OMA 1 1.010 - - QHG52283
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 1 1.000 - - FOG0002686
OrthoInspector 1 1.000 - - oto91059
orthoMCL 1 0.900 - - OOG6_105889
Panther 1 1.100 - - LDO PTHR46280
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 1 1.000 - - X3637
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.