DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and FYCO1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001373350.1 Gene:FYCO1 / 79443 HGNCID:14673 Length:1478 Species:Homo sapiens


Alignment Length:265 Identity:68/265 - (25%)
Similarity:109/265 - (41%) Gaps:51/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 YNK--QHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRK 136
            |||  |.:...|....:.:||......       ||.::         :|.:..:.:..:.|.:|
Human  1106 YNKLCQEVTNRERNDQKMLADLDDLNR-------TKKYL---------EERLIELLRDKDALWQK 1154

  Fly   137 SGKKPVENHAAV---WVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQST 198
            |.....:...:.   |:.||:|:.|:.||: :|:::.||||||.||.:.|..| ...::|.:...
Human  1155 SDALEFQQKLSAEERWLGDTEANHCLDCKR-EFSWMVRRHHCRICGRIFCYYC-CNNYVLSKHGG 1217

  Fly   199 KALRVCDACYERLKHVPSSLGS-------GEDSAAATGAASGNKLNTTAGDSSN----------- 245
            |..|.|.||:::|...|.|..|       ||.|.|.:.|:.|.:  .|.|..:|           
Human  1218 KKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGPQ--ATGGQGANTDYRPPDDAVF 1280

  Fly   246 DEDSDEETA--SPGGESHDEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVTPSVQSSPAA 308
            |..:|||..  ...|.|..|.....|:...:|.|..:|.||.:...|..:      |..|.|...
Human  1281 DIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTSTSLTPEDTEDM------PVGQDSEIC 1339

  Fly   309 VATTG 313
            :..:|
Human  1340 LLKSG 1344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 10/56 (18%)
PH 39..131 CDD:278594 10/58 (17%)
FYVE_PKHF 148..208 CDD:277257 23/62 (37%)
FYCO1NP_001373350.1 RUN 59..164 CDD:413440
SMC_prok_B 243..1050 CDD:274008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 586..613
PRK11281 978..>1164 CDD:236892 13/73 (18%)
FYVE_FYCO1 1170..1227 CDD:277265 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1231..1277 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1294..1332 10/43 (23%)
GOLD_2 <1419..1464 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.