DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and PLEKHF1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005259313.1 Gene:PLEKHF1 / 79156 HGNCID:20764 Length:364 Species:Homo sapiens


Alignment Length:278 Identity:139/278 - (50%)
Similarity:181/278 - (65%) Gaps:5/278 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYG 65
            |||.|.|:|.|::|||:||:|||:||.|||:.||||:|||||||.|||:.|.|.|||||||||||
Human    86 MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYG 150

  Fly    66 NIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV 130
            :||:.|:||..|||:|||||:||.:.:....:|.|.|:|..|||||.||::||:|||::||.:||
Human   151 SIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECV 215

  Fly   131 EDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQ 195
            ...||.:|:.|...|||.|:||....:||.|.:|:|:.:.||||||.||.||||.||.::||||:
Human   216 RRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPR 280

  Fly   196 QSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEETASPGGES 260
            .|.|.:|||..||..|........:.|..|.:.|..:..........|.:|:||||:  ..|...
Human   281 LSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDED--KEGSRD 343

  Fly   261 HDEP---RFYGDNSVLSA 275
            .|.|   .||......||
Human   344 GDWPSSVEFYASGVAWSA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 76/121 (63%)
PH 39..131 CDD:278594 56/91 (62%)
FYVE_PKHF 148..208 CDD:277257 31/59 (53%)
PLEKHF1XP_005259313.1 PH_Phafin2-like 92..214 CDD:269927 76/121 (63%)
PH 124..216 CDD:278594 56/91 (62%)
FYVE_PKHF1 233..296 CDD:277293 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52283
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 1 1.000 - - FOG0002686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105889
Panther 1 1.100 - - O PTHR46280
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.