DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and Plekhf1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_077724.2 Gene:Plekhf1 / 72287 MGIID:1919537 Length:279 Species:Mus musculus


Alignment Length:283 Identity:140/283 - (49%)
Similarity:184/283 - (65%) Gaps:15/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYG 65
            |||.|.|:|.|::|||:||:|||:||.|||:.||||:|||||||.|||:.|.|.|||||||||||
Mouse     1 MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYG 65

  Fly    66 NIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV 130
            :||:.|:||..|||:|||||:||.:.:....:|.|.|:|..|||||.||::||:|||::||.:||
Mouse    66 SIVLSKRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQEWISHIEECV 130

  Fly   131 EDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQ 195
            ...|..:|::|...|||.|:||....:||.|.:|:|:.:.||||||.||.||||.||.::||||:
Mouse   131 RRQLLATGRQPTTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPR 195

  Fly   196 QSTKALRVCDACYERL------KHVPSSLGSGEDSAAATGAASGNKLNTTAGDSS-NDEDSDEET 253
            .|.|.||||..||..|      :.....:|......:..|       .|..|.|| :|:||||:.
Mouse   196 LSPKPLRVCSLCYRELAAQKLREEAREGIGGSPPQLSHLG-------GTVCGASSGDDDDSDEDR 253

  Fly   254 ASPG-GESHDEPRFYGDNSVLSA 275
            ...| |:...:..||......||
Mouse   254 EGNGDGDWPTQVEFYASGVSWSA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 76/121 (63%)
PH 39..131 CDD:278594 56/91 (62%)
FYVE_PKHF 148..208 CDD:277257 32/59 (54%)
Plekhf1NP_077724.2 PH_Phafin2-like 7..129 CDD:269927 76/121 (63%)
FYVE_PKHF1 148..211 CDD:277293 34/62 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..263 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10546
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52283
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 1 1.000 - - FOG0002686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105889
Panther 1 1.100 - - O PTHR46280
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.